PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf30092g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 297aa    MW: 33179.4 Da    PI: 7.438
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf30092g00006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-18127181256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ +++keq  +Lee F+++++++ +++  L+k+l+L  rqV vWFqNrRa+ k
  Niben101Scf30092g00006.1 127 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALSKQLNLRPRQVEVWFQNRRARTK 181
                               788899***********************************************98 PP

2HD-ZIP_I/II125.23.1e-40127216191
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               +kk+rlskeq+++LEe+F+e+++L+p++K +l+++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r+++ l+een+rL+kev+
  Niben101Scf30092g00006.1 127 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALSKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCEGLTEENRRLQKEVT 211
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreel 91 
                               eLr +l
  Niben101Scf30092g00006.1 212 ELR-AL 216
                               **9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.9E-144103IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466895.13E-18120184IPR009057Homeodomain-like
PROSITE profilePS5007116.925123183IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.1E-17123186IPR009057Homeodomain-like
SMARTSM003896.6E-15125187IPR001356Homeobox domain
PfamPF000469.9E-16127181IPR001356Homeobox domain
CDDcd000863.23E-15127184No hitNo description
PROSITE patternPS000270158181IPR017970Homeobox, conserved site
PfamPF021831.9E-10183217IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.8E-25183226IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGGEKEDGLG LSLSLGRGCP KDNLKNDFIS PSTPPFLLPF MHNHQISAER KDEARESIRG  60
EIDMNRPVRM IESCDEELED EGVIMVSSPN YSTVSSVSGK RSHDREDNEG ERPTSSLEDD  120
GGDAAARKKL RLSKEQAAVL EETFKEHNTL NPKQKLALSK QLNLRPRQVE VWFQNRRART  180
KLKQTEVDCE YLRRCCEGLT EENRRLQKEV TELRALKLSP QMYMNMTPPT TLTMCPQCER  240
VAVSSSSSSA ASSSVTGAGV SRSNHLVGAL HQPPVSLNKP WAAIFSPKTL DVQRTQL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175183RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619639.10.0PREDICTED: homeobox-leucine zipper protein HAT3-like
RefseqXP_016462220.10.0PREDICTED: homeobox-leucine zipper protein HAT3-like
SwissprotP929539e-82ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLQ424371e-146Q42437_SOLLC; HD-ZIP protein
STRINGSolyc01g090460.2.11e-146(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.14e-74homeobox-leucine zipper protein 3